SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007937 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007937
Domain Number 1 Region: 95-290
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.85e-60
Family Astacin 0.0000675
Further Details:      
 
Domain Number 2 Region: 722-829
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-38
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 411-515
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-37
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 4 Region: 297-406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-36
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 5 Region: 562-672
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 6 Region: 853-946
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-27
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 673-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000652
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 518-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007937   Gene: ENSNLEG00000006519   Transcript: ENSNLET00000008320
Sequence length 957
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:32084008:32207331:1 gene:ENSNLEG00000006519 transcript:ENSNLET00000008320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIR
RIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRA
MFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFG
IVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSI
MHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQES
NGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRK
SPLLGRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSP
NYPDDYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRF
CGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGS
YQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRI
SVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDN
TVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHENKHDCKEAECEQ
KIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFD
GETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESK
PRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLD
STAVGLGRFCGSGPPEEIYSIGDAVLIHFHTDDTINKKGFHIRYKTIRYPDTTHTKK
Download sequence
Identical sequences ENSNLEP00000007937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]