SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008142 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008142
Domain Number 1 Region: 8-215
Classification Level Classification E-value
Superfamily vWA-like 1.24e-55
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 2 Region: 217-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 382-444
Classification Level Classification E-value
Superfamily vWA-like 0.00000024
Family Integrin A (or I) domain 0.0066
Further Details:      
 
Domain Number 4 Region: 455-496
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000811
Family Chicken cartilage matrix protein 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008142   Gene: ENSNLEG00000006692   Transcript: ENSNLET00000008529
Sequence length 500
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9068645:9082957:-1 gene:ENSNLEG00000006692 transcript:ENSNLET00000008529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLCWPVLLLLLQPWETQLQLAGPRCHTGPLDLVFVIDSSRSVRPFEFETMRQFLMGL
LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYA
MNVAFSVAEGARPPEERVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADVGS
LRAMASPPLDEHVFLVESFDLIQEFGLQFQSRLCGKDQCAEGGHGCQHQCVNAQGMFHCA
CNPGYKLAADNKSCLGIAWGHVFLKISSGGCATRAEKGSPGHRLTPSLPQPLICAPISVA
AKLALYSSRTRGAAGPLTTAALGHSCQHDVLAPCLMGGAVRVRRALLHLWEGGGKFRQMA
RAATVSDGREGVLLASAPLPTFGVLWCEYPSLVGIVMYAVGVGKAVEAELREIASEPAEL
HVSYAPDFGTMTHLLENLRGSICPEEGISAGTELRSPCECESLVEFQGRTLGALETASLT
SLAQLTARLEDLENQLANQK
Download sequence
Identical sequences ENSNLEP00000008142 ENSNLEP00000008142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]