SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008210 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008210
Domain Number 1 Region: 30-87
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008210   Gene: ENSNLEG00000006745   Transcript: ENSNLET00000008598
Sequence length 89
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9330200:9333358:-1 gene:ENSNLEG00000006745 transcript:ENSNLET00000008598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCRTYMMRWFFNLETGE
CELFAYGGCGGNSNNFSRKEKCEKFCKFT
Download sequence
Identical sequences G1R4T8
ENSNLEP00000008210 ENSNLEP00000008210 XP_003253689.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]