SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008211 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008211
Domain Number 1 Region: 34-71
Classification Level Classification E-value
Superfamily Elafin-like 0.00000222
Family Elafin-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008211   Gene: ENSNLEG00000006746   Transcript: ENSNLET00000008599
Sequence length 86
Comment pep:novel supercontig:Nleu1.0:GL397262.1:9353182:9358349:-1 gene:ENSNLEG00000006746 transcript:ENSNLET00000008599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSGLLPILVPFILLGDVQEPGHAEGIFGKPRPKIKVECKVEEIDQCTKPRDCPENMKC
CLFSRGKKCLDLRKVSLTLYHKEELE
Download sequence
Identical sequences G1R4T9
XP_003253691.1.23891 ENSNLEP00000008211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]