SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008215 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008215
Domain Number 1 Region: 83-146
Classification Level Classification E-value
Superfamily BPTI-like 7.95e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0039
Further Details:      
 
Domain Number 2 Region: 41-89
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000405
Family Elafin-like 0.0027
Further Details:      
 
Domain Number 3 Region: 149-194
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000107
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 4 Region: 194-239
Classification Level Classification E-value
Superfamily Elafin-like 0.000000641
Family Elafin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008215   Gene: ENSNLEG00000006749   Transcript: ENSNLET00000008603
Sequence length 241
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:9371010:9389286:-1 gene:ENSNLEG00000006749 transcript:ENSNLET00000008603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTVRTEGGHLPLHSPTFSWRNVAFLLLLFLALEWTSALLTKKIKHKPGLCPKERLTCTT
ELPDSCNTDFDCKEYLKCCFFACQKKCMDAFQEPCMLPVRHGNCNHDAQRWYFDFKNYRC
TPFTYKGCEGNANNFLSEDACRTACMLIVKDGQCPLFPFTERKECPPSCHSDIDCPQTDK
CCESRCGFVCTRAWTVKQGFCPRKPLLCAKIDKPKCLQDEECPLVEKCCSRCGLKCMNPR
H
Download sequence
Identical sequences G1R4U3
XP_003253692.1.23891 XP_003253693.1.23891 ENSNLEP00000008215 ENSNLEP00000008215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]