SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008272 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008272
Domain Number 1 Region: 32-112
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.28e-28
Family MHC antigen-recognition domain 0.00011
Further Details:      
 
Domain Number 2 Region: 116-210
Classification Level Classification E-value
Superfamily Immunoglobulin 8.94e-24
Family C1 set domains (antibody constant domain-like) 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008272   Gene: ENSNLEG00000006800   Transcript: ENSNLET00000008662
Sequence length 260
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:9870919:9887723:-1 gene:ENSNLEG00000006800 transcript:ENSNLET00000008662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPEDRMFHIRAMMLRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNIMIQRSNHTQAASDPPEV
TMFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TILILKAIRSGRDPRAQGPL
Download sequence
Identical sequences A0A2I3GC09
ENSNLEP00000008272 ENSNLEP00000008272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]