SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008287 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008287
Domain Number 1 Region: 273-424
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.12e-41
Family Dual specificity phosphatase-like 0.00025
Further Details:      
 
Domain Number 2 Region: 227-275
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000902
Family DEK C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008287   Gene: ENSNLEG00000006811   Transcript: ENSNLET00000008678
Sequence length 1027
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:13908479:13975397:-1 gene:ENSNLEG00000006811 transcript:ENSNLET00000008678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLPQHLQVMIN
LLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVL
RLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVA
LIWATYYESCISSEQSCINEWNAMQDLESTRPDSPALFVDKPTEGERTERLIKAKLRSIM
MSQDLENVTSKEIRNELEKQMNCNLKEFKEFIDNEMLLILGQMDKPSLIFDHLYLGSEWN
ASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINKAK
RNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEY
EGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPESRLPFLDDAAQPGL
GPPLPCCFRRLSDPLLPSPEDETGSLVHPEDPEREALLEEAAPPAEVHRPARQPQQGSGL
CEKDVKKKLEFGSPKGQSGSLLQVEEMEREEGLGAGRWGQLPTQLDQNLLNSENLNNNNS
KRSCPDGMEHDAIFGILNKVKPSYKSCADCMYPTASRAPEASRERCEDPNASAICTQPAF
LPHITSSPVAHLASRSRVPEKPASGPTEPPLFLPPAGSRRPDTSGPGAGAALEPPASVLE
PSRETPKVLPKSLLLKNAHCDKNPPSTEVVIKEELSPKKDMKPAKDLRLLFSNESEKPTT
NSYLMQHQESIIQLQKAGLVRKHTKELERLKSAPADPAPPSRDGPAGRLEASIPEESQDL
AALHELGPLVMPGQAGSNEKSEASPASLEGGSLKSPPPFLYRLDHTSSFSKDFLKTICYT
PTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLAKL
GSLNFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQATPRDPAATSKPSGKPAPENLKS
PLWMSKS
Download sequence
Identical sequences G1R515
ENSNLEP00000008287 ENSNLEP00000008287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]