SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008377 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008377
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-16
Family Cadherin 0.003
Further Details:      
 
Domain Number 2 Region: 112-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000228
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008377   Gene: ENSNLEG00000006879   Transcript: ENSNLET00000008771
Sequence length 152
Comment pep:novel supercontig:Nleu1.0:GL397262.1:10033313:10036168:-1 gene:ENSNLEG00000006879 transcript:ENSNLET00000008771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTEMYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESGSSGDVFKVTTDSDTQE
AIIVVQKRLDFESQPVHTVILEALNKFVDPRFADLGTFRDQAIVRVAVTDVDEPPEFRPP
SGLLEVQEDAQVGSLVGVVTARDPDAANRPVR
Download sequence
Identical sequences ENSNLEP00000008377 ENSNLEP00000008377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]