SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008628 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008628
Domain Number 1 Region: 159-307
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-42
Family Dual specificity phosphatase-like 0.000000454
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000000427
Family Cell cycle control phosphatase, catalytic domain 0.0000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008628   Gene: ENSNLEG00000007083   Transcript: ENSNLET00000009038
Sequence length 340
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:40114143:40121641:-1 gene:ENSNLEG00000007083 transcript:ENSNLET00000009038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HELFESSHIETAINLAIPAKRGGRLRKGNLPGGGGIPNHADKERFATRCKAATVLLYDEA
TAEWQPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSSS
PPTSVLGLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLGCAKD
STNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDE
ARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLL
DFERTLGLSSPCDNHAPSEQLYFSTPTNHNLFPLNTLEST
Download sequence
Identical sequences ENSNLEP00000008628 ENSNLEP00000008628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]