SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008845 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008845
Domain Number 1 Region: 312-383
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000327
Family Toll/Interleukin receptor TIR domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008845   Gene: ENSNLEG00000007252   Transcript: ENSNLET00000009265
Sequence length 697
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:45455853:45532881:-1 gene:ENSNLEG00000007252 transcript:ENSNLET00000009265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVGPASRNSGLYNITFKYDNCTTYLNPVGKHVIADAQNITISQYACHDQVAVTILWSPGA
LGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFKRTGMESQPFLNMKFETDYFVK
VVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAP
HNFGFRFFYLHYKLKHEGPFKRKTCKQEQNTETTSCLLQNVSPGDYIIELVDDTNTTRKV
MHYVLKPVHSPWAGPIRAMAITVPLVVISAFATLFTVMCRKKQQENIYSHLDEESSESST
YTAALPRERLRPRPKVFLCYSSKDGQNHMNVVQCFAYFLQDFCGCEVALDLWEDFSLCRE
GQREWVIQKIHESQFIIVVCSKGMKYFVDKKNYKHKGGGRGLGKGELFLVAVSAIAEKLR
QAKQSSSAALSKFIAVYFDYSCEGDVPGILDLSTKYKLMDNLPQLCSHLHSRDHGLQEPG
QHARQGSRRNYFRSKSGRSLYVAICNMHQFIDEEPDWFEKQFVPFHPPPLRYREPVLEKF
DSGLVLNDVMCKPGPESDFCLKVEAAVLGATGPADSQHESQHGDLDQDAEARPALDGSAA
LQPLLHTVKAGSPSDMPRDSGIYDSSVPSSELSLPLMEGLSTDQTETSSLTESVSSSSGL
GEEEPPALPSKLLSSGACKADLGCHSYTDELHAVAPL
Download sequence
Identical sequences ENSNLEP00000008845 ENSNLEP00000008845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]