SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008979 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008979
Domain Number 1 Region: 25-103
Classification Level Classification E-value
Superfamily Immunoglobulin 2.77e-27
Family I set domains 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008979   Gene: ENSNLEG00000007359   Transcript: ENSNLET00000009402
Sequence length 182
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:51910545:51920182:1 gene:ENSNLEG00000007359 transcript:ENSNLET00000009402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAKASNITWFKDGK
MIDFLSANKKKWNLGSNTKDPRGMYQCKGSQDKSKPLQVYYRMCQNCIELNAATISGFLF
AEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHIQGNQLR
RN
Download sequence
Identical sequences G1R707
ENSNLEP00000008979 ENSNLEP00000008979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]