SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009165 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009165
Domain Number 1 Region: 218-558,639-663
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.34e-92
Family Myotubularin-like phosphatases 0.00000697
Further Details:      
 
Domain Number 2 Region: 35-180
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-27
Family GRAM domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009165   Gene: ENSNLEG00000007537   Transcript: ENSNLET00000009605
Sequence length 774
Comment pep:known_by_projection supercontig:Nleu1.0:GL397490.1:48968:102613:-1 gene:ENSNLEG00000007537 transcript:ENSNLET00000009605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKPPRPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKINGIPSGDGGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASGWRVCS
INEGYMISTCLPEYFVVPSSLADQDLKIFSHSFVGRRMPLWCWSHSNGSALVRMALIKDV
LQQRKIDQRICNAITKSHPQRSDVYKSDLDKTLPNIQEVQAAFVKLKQLCVNEPFEETEE
KWLSSLENTRWLEYVRAFLKHSAELVYMLESKHLSVVLQEEEGRDLSCCVASLIQVMLDP
YFRTIIGFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPAAFEF
SETYLAVLYDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLGDEKGLKFPSVWDWSLQ
FTAKDRTLFHNPFYIGKSTPCIQNGSVKSFKRTKKSYSSTLRGMPSALKNGIISDQELLP
RRNSLILKPKPDPPQQTDSQNSDTEQYFREWFSKPVNLHGVILPRVSGTHIKLWKLCYFR
WVPEAQISLGGSITAFHKLSLLADEVDVLSRMLRQQCSGPLEACYGELGQSRMYFNASGP
HDTDTLGTPEFLSSSFPFSPVGNLCRRSILGTPLSKFLSGAKIWLSTETLANED
Download sequence
Identical sequences G1R7I7
ENSNLEP00000009165 ENSNLEP00000009165 XP_003280357.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]