SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009578 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009578
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 2e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000339
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.15e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 430-490
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000123
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009578   Gene: ENSNLEG00000007859   Transcript: ENSNLET00000010036
Sequence length 502
Comment pep:known_by_projection supercontig:Nleu1.0:GL397404.1:206361:215822:1 gene:ENSNLEG00000007859 transcript:ENSNLET00000010036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPPH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSSADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGVAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences G1R8P1
XP_003276872.1.23891 XP_012354168.1.23891 ENSNLEP00000009578 ENSNLEP00000009578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]