SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009618 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009618
Domain Number 1 Region: 432-567
Classification Level Classification E-value
Superfamily TIMP-like 7.06e-31
Family Netrin-like domain (NTR/C345C module) 0.033
Further Details:      
 
Domain Number 2 Region: 209-304
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 385-437
Classification Level Classification E-value
Superfamily BPTI-like 9.65e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 324-380
Classification Level Classification E-value
Superfamily BPTI-like 7.09e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 123-172
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 37-88
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009618   Gene: ENSNLEG00000007890   Transcript: ENSNLET00000010078
Sequence length 576
Comment pep:known_by_projection supercontig:Nleu1.0:GL397344.1:384125:393329:1 gene:ENSNLEG00000007890 transcript:ENSNLET00000010078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQS
TCRRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQG
SECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAIVTCRYHFT
WPNTSPPPPETTIHPTTASPETPELDMAAPALLNNPVHQSVTMGETVSFLCDVVGRPRPE
ITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNAAGVLRADF
PLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGDEQTRWHFDAQANNCLTFTFGH
CHRNLNHFETYEACMLACMNGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGR
ALVTVDEVLKDEKMGLKFLGREPLEVTLLHVDWACPCPNVSVSETPLIIMGEVEGGMAML
RPDSFVGASSARRVRKLREVMHKKTCDVLKEFLGLH
Download sequence
Identical sequences A0A2I3H3L6
XP_003272312.1.23891 ENSNLEP00000009618 ENSNLEP00000009618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]