SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009965 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009965
Domain Number 1 Region: 16-67
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000464
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 2 Region: 163-219
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000847
Family B-box zinc-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009965   Gene: ENSNLEG00000008179   Transcript: ENSNLET00000010450
Sequence length 272
Comment pep:known_by_projection supercontig:Nleu1.0:GL397399.1:135859:138471:1 gene:ENSNLEG00000008179 transcript:ENSNLET00000010450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECR
ETVPVPPEGVAAFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSAGGPATARC
LDCADDLCQACADGHRCTRQTHTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFL
CQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEGLLAGVDNNLVELEAARRVEKEA
LARLREQAARVGTQVEEAAEGVLRALLAQKQE
Download sequence
Identical sequences ENSNLEP00000009965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]