SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009980 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009980
Domain Number 1 Region: 383-468
Classification Level Classification E-value
Superfamily Immunoglobulin 4.8e-21
Family I set domains 0.0083
Further Details:      
 
Domain Number 2 Region: 1887-1975
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 3230-3319
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 3143-3235
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-19
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 1982-2067
Classification Level Classification E-value
Superfamily Immunoglobulin 9.42e-19
Family I set domains 0.037
Further Details:      
 
Domain Number 6 Region: 3505-3584
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 3429-3510
Classification Level Classification E-value
Superfamily Immunoglobulin 4.43e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 3040-3134
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-17
Family I set domains 0.042
Further Details:      
 
Domain Number 9 Region: 2954-3049
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 10 Region: 1714-1801
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-16
Family I set domains 0.0000262
Further Details:      
 
Domain Number 11 Region: 2367-2454
Classification Level Classification E-value
Superfamily Immunoglobulin 5.3e-16
Family I set domains 0.05
Further Details:      
 
Domain Number 12 Region: 2469-2553
Classification Level Classification E-value
Superfamily Immunoglobulin 7.11e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 13 Region: 2561-2647
Classification Level Classification E-value
Superfamily Immunoglobulin 8.2e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 14 Region: 2662-2748
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000118
Family I set domains 0.054
Further Details:      
 
Domain Number 15 Region: 3332-3423
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000185
Family I set domains 0.021
Further Details:      
 
Domain Number 16 Region: 2177-2258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000195
Family I set domains 0.057
Further Details:      
 
Domain Number 17 Region: 2086-2170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000292
Family I set domains 0.064
Further Details:      
 
Domain Number 18 Region: 2856-2941
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000127
Family I set domains 0.072
Further Details:      
 
Domain Number 19 Region: 2758-2844
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000251
Family I set domains 0.036
Further Details:      
 
Domain Number 20 Region: 2275-2361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000986
Family I set domains 0.08
Further Details:      
 
Domain Number 21 Region: 1542-1594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 22 Region: 345-388
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 23 Region: 261-298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 743-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 25 Region: 1138-1190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 26 Region: 803-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 27 Region: 177-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 302-338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 29 Region: 1198-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 30 Region: 1775-1841
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000103
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009980
Domain Number - Region: 1677-1713
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000124
Family I set domains 0.062
Further Details:      
 
Domain Number - Region: 1254-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number - Region: 866-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 1101-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family Laminin-type module 0.092
Further Details:      
 
Domain Number - Region: 1375-1446
Classification Level Classification E-value
Superfamily PEP carboxykinase N-terminal domain 0.0575
Family PEP carboxykinase N-terminal domain 0.0055
Further Details:      
 
Domain Number - Region: 1507-1544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009980   Gene: ENSNLEG00000008145   Transcript: ENSNLET00000010465
Sequence length 3629
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:2825368:2891971:-1 gene:ENSNLEG00000008145 transcript:ENSNLET00000010465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHGLRAYDGLSLPEDTETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQM
VYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELD
GWVFVELDVGSEGNADGAQIQEVLLRVISSGSMASYITSPQGFQFRRLGTVPQFPRACTE
AEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLGISPTFSLLVETTPLPPRPETT
IMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRSGHCIPRDYLCDGQEDCEDGSDELDCGP
PPPCEPNEFPCNGHCALKLWRCDGDFDCEDRTDEASCPTKRPEEVCGPTQFRCVSTNTCI
PASFHCDEESDCPDRSDEFGCMPPQVVTPPQESIQASRGQTVTFTCVAIGVPTPIINWRL
NWGHILSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQR
GPCPDGHFYLEHSAACLPCFCFGITSVCQSSRRFRDQIRLHFDQPDDFKGAVNVTMPAQP
GTPPLSSTQLQIDPSLHKFQLVDLSRRFLVHDSFWSLPVQFLGNKVDSYGGSLRYNVRYE
LARGMLEPVQRPDVVLVGAGYRLLSRGHTPTQPGVLNQRQVQFSEEHWVHESGRPVQRAE
LLQVLQSLEAVLIQTVYNTKMASVGLSDITMDTTVTHATSHGRAHSVEECRCPIGYSGLS
CESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPAYGHCLNCQHNTEGPQCNKCKAGFFG
DATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGN
PIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGSFHLSTRNPDGC
LKCFCMGVSRHCTSSSWSRAQVHGASEEPGHFSLTNAASTHTTNEGIFSPTPGELGFSSF
HRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIILEH
HVAQEPSPGQPSTFTVPFREQAWQRPDGQPATREHLLMALAGIDTLLIRAAYAQQPAESR
VSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDCDTGYTRTPSGLYLGTCERCSC
HGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQRGTPQDCQLCPCYGDPAAGQAA
HTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDGQVPGPIGCNCDPQG
SVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPDGCLPCFCMGITQQCASSTYTR
HLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAHLGHESFYWQLPE
TYQGDKVAAYSGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPALQGPGRRSYEI
VFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPSNG
PRALEVEECRCPPGYIGLSCQDCAPGHTRTGSGLYLGHCELCECNGHSDLCHPETGACSQ
CQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTAC
EPGYTGQYCEQTNGGLPSESLKGCCSEKSLLDYAPSLPQTLLRCHIALGTSPTSLGSFTP
SDAGVYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSK
SPAYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQ
ASGTSSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPLEWTAHSSAGQQVARAVLHVHGE
RPGSGWGPGVCSAQGASSRLLSAGGGGPRVQVSPERTQVHEGRTVRLYCRAAGVPSATIT
WRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQVVVLSASDA
SPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGSRLRLPQVS
PADSGEYVCRVENGSGPKEASITVSVLHGSHSGPSYTPVPGSAHPIRIEPSSSHVAEGQT
LDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVTPADSGEYVCRVVGTSGPLE
ASVLVTIEASVIPGPVPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPAR
HQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGSTQPIRIEPS
SSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQVSPADSGEYVCR
VLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSHVAEGQTLDLNCLVAGQAHAQV
TWHKRGGSLPARHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTIQQRLSGSH
SQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIP
QVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPTVVEGQTLD
LNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANNNIDALEAS
IVISVSPSTGSPSAPGSSMPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLP
SHHQTHGSRLRLHQVSPADSGEYVCRVMGSSGPLEASVLVTIEASGSSAVHVPAPGGAPP
IRIETSSSRVAEGQTLDLKCVVPGQAHAQVMWHKRGGNLPARHQVHGPLLRLNQVSPADS
GEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQTLDLNCVV
PGQAHAQVTWYKRGGSLPARHQTHGSQLRLHHVSPADSGEYVCRAAGGPSPEQEASFTVT
VPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRNQELEDNVH
ISPNGSIITIVGTRPSNHGTYRCVASNAYGVAQSVVNLSVQGPPTVSVLPEGPVWVKVGK
AVTLECVSAGEPRSSAHWTRISSTPAKLEQRTYGLMDSHAVLQISSAKPSDAGTYVCLAQ
NALGTAQKKVEVIVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPTPTIHWSKL
RSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPYATTVPEHA
SVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDSGRYRCRVT
NKVGSAEAFAQLLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDPG
TQLRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGMYICQAHGPWGKAQASAQLVVQALPS
VLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVVRIAHVELA
DAGQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASGYPTPDISW
TKLDGTLPPDSRLENNMLMLPSVRPQDAGTYVCTATNRQGKVKAFHLQVPERVVPYFTQP
YSFLPLPTIKDAYRKFEIKITFRPDSADG
Download sequence
Identical sequences ENSNLEP00000009980 ENSNLEP00000009980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]