SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010329 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010329
Domain Number 1 Region: 146-302
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.39e-30
Family Dual specificity phosphatase-like 0.00094
Further Details:      
 
Domain Number 2 Region: 3-152
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000000183
Family Multidomain sulfurtransferase (rhodanese) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010329   Gene: ENSNLEG00000008461   Transcript: ENSNLET00000010836
Sequence length 313
Comment pep:known_by_projection supercontig:Nleu1.0:GL397399.1:2012698:2066090:1 gene:ENSNLEG00000008461 transcript:ENSNLET00000010836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLLLCEPTELYNILNQATKLSRLTEPNYLCLLDVRSKWEYDESHVITALLVKKKNNEY
LLPESVDLECVKYCVVYDNNTSTLERLLKDDDDDSDSNGDGKDLVPRAAIEYGRILTRLT
RHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIMPGKVFIGNFSQACDPK
IQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHLHLGS
VVLIFSTQGISRSCAAVIAYLMHYNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTI
LGDSITNVTDPLY
Download sequence
Identical sequences G1RAT2
ENSNLEP00000010329 XP_003276704.1.23891 XP_004090957.1.23891 XP_012351824.1.23891 XP_012351825.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]