SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010577 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010577
Domain Number 1 Region: 156-236
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000113
Family Ricin B-like 0.012
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000000619
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010577   Gene: ENSNLEG00000008672   Transcript: ENSNLET00000011093
Sequence length 243
Comment pep:known_by_projection supercontig:Nleu1.0:GL397827.1:41261:47465:-1 gene:ENSNLEG00000008672 transcript:ENSNLET00000011093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVWQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWK
PMTNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRIYNNTLTYGEVAPPPRAPSAL
TPAHTCAFRALAQPCGITVLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGRGRMPTLKKC
EDVTRPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKH
ARH
Download sequence
Identical sequences ENSNLEP00000010577 ENSNLEP00000010577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]