SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010846 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010846
Domain Number 1 Region: 34-467
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.09e-71
Family Integrin alpha N-terminal domain 0.0000131
Further Details:      
 
Domain Number 2 Region: 762-998
Classification Level Classification E-value
Superfamily Integrin domains 2.14e-42
Family Integrin domains 0.0027
Further Details:      
 
Domain Number 3 Region: 621-757
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-22
Family Integrin domains 0.0032
Further Details:      
 
Domain Number 4 Region: 467-620
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-21
Family Integrin domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010846   Gene: ENSNLEG00000008858   Transcript: ENSNLET00000011375
Sequence length 1069
Comment pep:known_by_projection supercontig:Nleu1.0:GL397531.1:561025:593888:1 gene:ENSNLEG00000008858 transcript:ENSNLET00000011375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRPSRAPRAPRLMLCALALMVAAGDCVGSSSFNLDTRIPGWKEAGDPGAAFFGYSVAP
PMGRTERQQAPRLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHH
IIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDW
QTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEY
SYKDPEDQGNLYIGYTVQVGIAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQV
LEGSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPAHP
SLLLHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVI
HGEKLGLPGLATFGYSLSGQMDVDDNFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARP
AVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRWDPLESTCSESA
VFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPIL
NQAQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINV
TNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKQNQRMELL
IAFEVIGVTLHTRELQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGG
TVMGESGMKTVQDVGSSLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEIT
VHGNGSWPCQPPGDLINPLNLTLSDSGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAK
SETVLTCATGRAHCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYGDFDRVRVNGWATLF
LRTSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCD
FFKRTRYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDRYY
Download sequence
Identical sequences ENSNLEP00000010846 ENSNLEP00000010846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]