SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011695 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011695
Domain Number 1 Region: 34-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.98e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-18
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 512-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000175
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 211-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000837
Family KRAB domain (Kruppel-associated box) 0.0047
Further Details:      
 
Domain Number 8 Region: 374-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000572
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011695   Gene: ENSNLEG00000009603   Transcript: ENSNLET00000012271
Sequence length 683
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:3214336:3222648:1 gene:ENSNLEG00000009603 transcript:ENSNLET00000012271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRPRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERAFSAPWLSLFPPEGNVEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRV
LSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF
ENLEGVLSVSSENTHPQVLLPDQARGEVPWSPELGRHRDRPQGDWAPPPEGGTEQALAGA
SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGMDCSEIFGGNPR
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CPECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences G1REP5
ENSNLEP00000011695 XP_003269249.1.23891 ENSNLEP00000011695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]