SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011823 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011823
Domain Number 1 Region: 200-539,620-641
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.2e-76
Family Myotubularin-like phosphatases 0.0000132
Further Details:      
 
Domain Number 2 Region: 43-174
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000221
Family GRAM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011823   Gene: ENSNLEG00000009701   Transcript: ENSNLET00000012406
Sequence length 709
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:667009:675232:-1 gene:ENSNLEG00000009701 transcript:ENSNLET00000012406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWGGRGQSFNIVPQKEEPEMGSVQENRMPEPRSHQPSSCLASRCLPGEQILAWAPGVRK
GLEPELSGTLICTNFRVTFQPCGWQWSQDTPLSSEYDFALVNIGRLEAVSSLSRVQLLRP
GSLLKFIPEEILIHGRDFRLLRVGFEAGGLEPQAFQVTMAIVQARAQSNQAQQYSGITLS
KAGQGSGSRKPPIPLMETGEDWETERKKQAARGWRVSTVNERFDVATSLPRYFWVPNRLL
DSEVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDV
VLVDTMDELPSLADIQLAHLRLRALCLPDSSVAEDKWLSALEGTRWLDYVRACLRKASDI
SVLVTSRVRSVILQERGDRDLNGLLSSLVQLLSAPEARTLFGFQSLVQREWVAAGHPFLT
RLGGTGASEEAPVFLLFLDCVWQLLQQFPADFQFSEFFLLALHDSVRVPDTLTFLRNTPW
ERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHC
SDSWLPRPQPSFMVPGPPSSVWLFSRGALTPLNQLCPWRDSPSLLAVSSRWLPRPAISSE
SLADQEWGLPSHWGACPLPPGLLLPGYLGPQIRLWRRCYLRGRPEVQMGLSAPTISGLQD
ELSHLQELLRKWTPRISPEDHSKKRDPHTILNPTEIAGILKGRAEGDLG
Download sequence
Identical sequences G1RF23
ENSNLEP00000011823 XP_003259206.1.23891 ENSNLEP00000011823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]