SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012032 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012032
Domain Number 1 Region: 208-413
Classification Level Classification E-value
Superfamily RNI-like 1.86e-20
Family 28-residue LRR 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012032   Gene: ENSNLEG00000009879   Transcript: ENSNLET00000012617
Sequence length 481
Comment pep:known_by_projection supercontig:Nleu1.0:GL397361.1:6450974:6454496:-1 gene:ENSNLEG00000009879 transcript:ENSNLET00000012617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRMSLRAPRRLLELAGQSLLRDQALAISVLGELPRELFPPLFVEAFTGRRCEVLKVMVQA
WPFTCLPLGSLMKTPDLEILYYVVDGIDCLLAQKVRPRRWKLQVLDLRDVDENFWAIWSG
VKVLSRSPEAMSKRQTVEDCPRTGEKQPLKVFIDVCLKEKSVDEDLSFFSGWVRHRRGSV
HLCCTKVVNYSTNILNFRNILETVYPDSIQVLEIWNMCCTCMIVQFSRYLSQMRNLRKLF
ISDGCCYLPSLDSQEQLVAEFSSVFPRLEYLQMLYIRRVCFFEGYLDQLIRCLKSPLETL
ALTYGSLEEEDLKCLPQYPSLSQLKQLNLSHGALRFIRLEPLRALLEKVAATLQTLFLVD
CGIRDSKLRVILPALSRCSNLTTFCFHGNDTSMDVLKDLLRHTRRLRNLSLETYPAPRES
LDDRGHVVWELLTPLQAELMRILREVRQPNRIFFGPVSCPCCGTLPTEQLEFNFCFWGRP
A
Download sequence
Identical sequences ENSNLEP00000012032 ENSNLEP00000012032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]