SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012343 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012343
Domain Number 1 Region: 65-226
Classification Level Classification E-value
Superfamily RNI-like 1.1e-46
Family 28-residue LRR 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012343   Gene: ENSNLEG00000010125   Transcript: ENSNLET00000012943
Sequence length 229
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:1899968:1906217:-1 gene:ENSNLEG00000010125 transcript:ENSNLET00000012943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKPYIQPKREIPGEEQITLEPELEEALAHATDAEMCDIAAVVSSFSCVVQPDKYKPVPDE
PPNPTNIEEILKRVRSNDKELEEVNLNNIQDIPIPMLSELCEAMKANTYVRSFSLVATRS
GDPIANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGD
AVEMEMATVLEQCPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR
Download sequence
Identical sequences ENSNLEP00000012343 ENSNLEP00000012343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]