SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012433 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012433
Domain Number 1 Region: 80-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000153
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 484-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000107
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 714-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000327
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 532-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000321
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 622-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000197
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 776-800
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000261
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 576-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000439
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012433
Domain Number - Region: 138-169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00453
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012433   Gene: ENSNLEG00000010204   Transcript: ENSNLET00000013040
Sequence length 884
Comment pep:known_by_projection supercontig:Nleu1.0:GL397482.1:1359435:1365409:-1 gene:ENSNLEG00000010204 transcript:ENSNLET00000013040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGRRLPGSSKSGPGKDGSRKEVRLPMLHDPLKMGMPVVRGGQTVPGQAPLCFD
PGSPASDKTEGKKKGRPKAENQALRDIPLSLMNDWKDEFKAHSRVKCPNSGCWLEFPSIY
GLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPASKPGPISRPV
TISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRPMPVTKAIPVTRPVPVTKPV
PVSRPMPVTKAIPVTRPVPVTKPITVTKSVPVTKPVPVTKPITVTKLVTVTKPVPVTKPV
TVSRPIAISRHTPPCKMVLLTRSENKAPRATGRNSGKKRAADSLDTCPIPPKQARPENGE
YGPSSMGQSSAFQLSADASSGSLSPGSRPSGGMEALRAAGPASPPEEDPERTKHRRKQKT
PKKFTGEQPSISGTFGLKGLVKAEDKARVHRSKKQEGGPEDARKKVPAAPITVSKEAPAP
VAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQHCRK
QFKSKAGLNYHTMAEHSAKPSDAEASEGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSS
LMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPVSALFCGTSAC
SSPWSLGGTCRGLSLGTATAVTHPLPPPSAASVFRAAGVSSGLGLTLVLSNSQLNYTRPG
LPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGAHLAGKYRCLL
CPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLVPKKEKKKNLAGGKKRGRKP
KERPPEGPVAKLPPRRDDWPPGCRDKGARGSTGRKVGASKAPEK
Download sequence
Identical sequences ENSNLEP00000012433 ENSNLEP00000012433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]