SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012568 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012568
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000141
Family RING finger domain, C3HC4 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012568   Gene: ENSNLEG00000010318   Transcript: ENSNLET00000013182
Sequence length 196
Comment pep:known_by_projection supercontig:Nleu1.0:GL397704.1:87148:95576:1 gene:ENSNLEG00000010318 transcript:ENSNLET00000013182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCTLHGESISRCLGWCPQPVPVLGG
RAHPQVPINTASPTPGQHTGSLMSREESSRSPGPTPPALDQETSSLLRCTSPWCLDHSCD
LFGITDQVSADEPRACRQGAWRRLPAGVGPVLPLLPHALHPQVAARAAGAAALPHVPPGM
EVQGVRPDLALAGGAS
Download sequence
Identical sequences ENSNLEP00000012568 ENSNLEP00000012568 XP_012359376.1.23891 XP_012359377.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]