SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012949 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012949
Domain Number 1 Region: 386-834
Classification Level Classification E-value
Superfamily RNI-like 2.06e-73
Family 28-residue LRR 0.0000374
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012949
Domain Number - Region: 11-74,103-160
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0473
Family RecA protein-like (ATPase-domain) 0.085
Further Details:      
 
Domain Number - Region: 334-393
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0863
Family SMI1/KNR4-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012949   Gene: ENSNLEG00000010637   Transcript: ENSNLET00000013584
Sequence length 853
Comment pep:known_by_projection supercontig:Nleu1.0:GL397560.1:338635:352334:-1 gene:ENSNLEG00000010637 transcript:ENSNLET00000013584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXLAKKCMLDWTDCNLSPTVRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPSILAQ
AQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPKAALLVTTRPR
VLRDLQLLAQQPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPA
VCWIVCTTLKLQMEKGEDPAPTCLTRTGLFLRFLCSQFPQGGQLRGALRKLSLLAAQGLW
AQMSVLHREDLERLGVQESDLRPFLDGHILRQDRDSKGCYSFIHLSFQQFFAALFYALEK
EEEEDRDGHAWDIGDVQKLLSGEERLKDPDLIQVGHFLFGLANEKRAKELEATFGCQMSP
DIKQELLRCKAHLHANKSISMTDLKEVLCCLYESQEEELAKVVVAPFKEISVHLTNISEM
MQCSFSLKHCQDLQKLSLQVAKGVFLENYVGFEPDIEFERCTYLTIPNWARQDLRSLRLW
TDFCSLFSSNSNLKFLKVKQSFLSDFSVRILCDHVTRSTCHLQKVEIKNVTPDTAYRDFC
LAFIGKKTLTHLTLEGHIEWERTMMLMLCDLLRNHKCKLQYLRLGGHCATPEQWAEFFYV
LKANESLKHLHLSANVLLDEGAQLLYKTMTHPEHFLQMLSLENCRLTEASCKDLAAVLVV
SQKLTHLCLAKNPIGDTGVKFLCEGLSYPDCKLQTLVLQQCSITKLGCRYLSEALQEACG
LTHLDLSLNQIARGLWILCQALENPNCNLKHLRLWSCSLMPFYCQHLGSALISNQKLETL
DLGQNHLWKSGIIKLFGVLRQRTGSLKTLRLKTYETNLEIKKLLEEVKEKNPKLTIDCNA
SGPTAPPCCDFFC
Download sequence
Identical sequences ENSNLEP00000012949 ENSNLEP00000012949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]