SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013301 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013301
Domain Number 1 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 387-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 22-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 428-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.38e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 141-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000325
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013301
Domain Number - Region: 231-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000707
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013301   Gene: ENSNLEG00000010960   Transcript: ENSNLET00000013955
Sequence length 489
Comment pep:known_by_projection supercontig:Nleu1.0:GL397411.1:2159047:2163873:-1 gene:ENSNLEG00000010960 transcript:ENSNLET00000013955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEPMGPAQVPMNSEVIVDPIQGQVNFEDVFVYFSQEEWVLLDEAQRLLYRDVMLENF
ALMASLGHASFMSHIVASLVMGSEPWVPDWVDMTLAVATETPGGSGPGCWHGMEDEEIPF
EQSFSIGMSQIRIPKGGPSTQKAYPCGTCGLVLKDILHLAEHQETHPGQKPYMCVLCGKQ
FWFSANLHQHQKQHSGEKPFRRDKNRAFLVNNCAVQSSEMSFVTGEACKDFLASSSIFQH
HVPHNEWKPHSNNKCEEASHCGKRHYKCSECGKTFGRKDSLVQHQRVHTGERPYECGECG
KTFSRKPILAQHQRIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKAYS
HKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKHWSVHTGARPYECIACGKFFSQSSD
LIAHQRVHNGEKPYVCSECGKAFSHKHVLVQHHRIHTGERPYKCSECGKAFRQRASLIRH
WKIHTGERP
Download sequence
Identical sequences A0A2I3HJV6
XP_003277278.1.23891 ENSNLEP00000013301 ENSNLEP00000013301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]