SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013416 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013416
Domain Number 1 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 57-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 689-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 577-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 635-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 731-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 371-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000832
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 10 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000427
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013416   Gene: ENSNLEG00000011055   Transcript: ENSNLET00000014080
Sequence length 793
Comment pep:known_by_projection supercontig:Nleu1.0:GL397411.1:2700843:2725256:-1 gene:ENSNLEG00000011055 transcript:ENSNLET00000014080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGALTDQSWGMTAVDPWASWALCPQDPAWHVEGRLEEGRRATGLPAAQVQE
PVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEP
WSVEQACPQRTGPEWVRNLESKALIQAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCK
DQLEMYHMNQSTAMRQMVFMQKQVLSQRSSEFCELGAEFSQNLNFVPSQRVSQIEHFYKP
DTRAESWRCDSAIMYADKVTCENNNDYDKTVYQSIHPIYPARIQTGDNLFRCTDAVKSFN
HIIHFGDHKGIHTGEKLYEYKECHQIFNQSPSFNEHSRLHVGENQYNYKEYENIFYFSSF
MEHQKIGTVDKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYDYNECGTSFIWSSYLIQHK
KTHTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHT
GEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKP
FKCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQ
ECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGK
SFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNE
SSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSECGKAFSGHSAL
LQHQRNHSEEKLN
Download sequence
Identical sequences G1RJK9
ENSNLEP00000013416 XP_003277265.1.23891 XP_004089151.1.23891 ENSNLEP00000013416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]