SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014014 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014014
Domain Number 1 Region: 13-49
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 99-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000484
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 64-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000681
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014014   Gene: ENSNLEG00000011528   Transcript: ENSNLET00000014702
Sequence length 142
Comment pep:known_by_projection supercontig:Nleu1.0:GL398258.1:1436:4744:1 gene:ENSNLEG00000011528 transcript:ENSNLET00000014702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAHSGPQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSLPHF
LVAHCGDPASWIYSDQKCDGTNNCGDCSDEMSPVTVCPPCGPGWWRCPSTFFKYCDCIPR
RLCHDHVQHCSDWSDEYACPGP
Download sequence
Identical sequences ENSNLEP00000014014 ENSNLEP00000014014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]