SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014016 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014016
Domain Number 1 Region: 97-216
Classification Level Classification E-value
Superfamily PX domain 7.63e-16
Family PX domain 0.0036
Further Details:      
 
Domain Number 2 Region: 298-352
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000295
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 894-924
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000384
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014016   Gene: ENSNLEG00000011527   Transcript: ENSNLET00000014704
Sequence length 948
Comment pep:known_by_projection supercontig:Nleu1.0:GL397346.1:8278424:8360572:-1 gene:ENSNLEG00000011527 transcript:ENSNLET00000014704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLNGGGGHGGKGAPGPGGALPTCPACHKITPRTEA
PVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKVSVEKIDLKGLSHTKNDRNVECSFEV
LWSDSSITSVTKSSSEVTEFISKLSQLYPEENLEKLIPCLAGPDAFYVERNHVDLDSGLR
YLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSGRPVCGVAGIPS
SQSGAQHHGQHPAGSAAPLPHCSHGGSAGSALAYRTQMDTSPAILMPSSLQTPQTQEQNG
ILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKSVKWV
LKPVFISVSHVPNGVLRLPTESHSVPCVPLEGAPADKLRVEVEQPHHQLPREGSSSEYSS
SSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLNHFTSSSARPTAQVLPVQN
EASSNPSGHHPLPPQMLSAASHIAPIRMLNSVHKPERGSADMKLLSSSVHSLLSLEERNK
GSGPRSSMKVDKSFGSAMMDVLPTSAPHQPVQVLSGLSESSSMSPTVSFGPRTKVVHAST
LDRVLKTAQQPALVVETSTAATGTPSTVLHAARPPIKLLLSSSVPADSAISGQTSCPNNV
QISVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQGGFCANSNTASPSSHPSTSFANMA
TLPSCPAPSSSPALSSVPESSFYSSSGGGGSTGNIPASNPNHHHHHHHQQPPAPPQPAPP
PPGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTFPFLPFSPMCSSGYVSAQQY
GGGSTFPVVHAPYSSSGTPDPVLSGQSTFAVPPMQSFMAGTAGVYQTQGLVGSSNGSSHK
KSGNLSCYNCGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSNLEP00000014016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]