SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014240 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014240
Domain Number 1 Region: 23-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000759
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014240
Domain Number - Region: 129-167
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.034
Family (Pro)aerolysin, pore-forming lobe 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014240   Gene: ENSNLEG00000011714   Transcript: ENSNLET00000014940
Sequence length 295
Comment pep:known_by_projection supercontig:Nleu1.0:GL397427.1:2297557:2402347:1 gene:ENSNLEG00000011714 transcript:ENSNLET00000014940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPLLIPSHFLGGGSAGSSPSLPYGVTQPKRLSAPMGGSVEIPFSFCYPWELATAPNMKI
SWRRGHFHGQFFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRILNLRKEDQSVYFCRVEL
DTPRSGRQQWQSIEGTKLSITQAVTTTTTWRASSPTTTWRLSSTTTTAGLRVTQGKRRSD
SWHISLETAMGVAVAVAVLGITILGLICLLRWRRRKGKCPGPALSPNREPFQNTEEPYEN
IRNEGQNTDPKLNPKDDGIIYASLALSSSTSPIAPPSRHPLKSPRNDTLYSVLKA
Download sequence
Identical sequences ENSNLEP00000014240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]