SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014248 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014248
Domain Number 1 Region: 396-487
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.75e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 265-436
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.11e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014248   Gene: ENSNLEG00000011697   Transcript: ENSNLET00000014950
Sequence length 580
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:13118238:13283645:1 gene:ENSNLEG00000011697 transcript:ENSNLET00000014950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPTSVGGGGGASSPSAAAAAAAAAA
ASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIG
YKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGYDKASLYSLALKCLISLSTI
ILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTA
RLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTR
FVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSI
GYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRV
KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTL
VDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDF
IEAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences ENSNLEP00000014248 ENSNLEP00000014248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]