SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014645 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014645
Domain Number 1 Region: 36-205
Classification Level Classification E-value
Superfamily Cyclophilin-like 6.57e-71
Family Cyclophilin (peptidylprolyl isomerase) 0.00000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014645   Gene: ENSNLEG00000012061   Transcript: ENSNLET00000015377
Sequence length 212
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:22153611:22166136:-1 gene:ENSNLEG00000012061 transcript:ENSNLET00000015377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGPRLLLPLVLCVGLGALVSSSGAKGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFG
KVVPKTVENFVALATGEKGYGYKGSRFHRVIKDFMIQGGDITAGDGTGGVSIYGETFPDE
NFRLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQA
TDGHDRPLTNCSIVNSGKIDVKTPFVVEVADW
Download sequence
Identical sequences G1RN31
ENSNLEP00000014645 XP_003259936.1.23891 ENSNLEP00000014645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]