SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014787 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014787
Domain Number 1 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 71-132
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 326-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000562
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014787
Domain Number - Region: 229-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00179
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00504
Family SCAN domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014787   Gene: ENSNLEG00000012184   Transcript: ENSNLET00000015531
Sequence length 526
Comment pep:known_by_projection supercontig:Nleu1.0:GL397355.1:5299838:5320432:1 gene:ENSNLEG00000012184 transcript:ENSNLET00000015531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLMTLPTEASTWVKLQHPKKATEGAPLWEDVTKMFEGEALLSQDADDIKTQRESLE
DEVTPGLPTAESQELLTFKDISIDFTQEEWGQLAPAHQSLYREVMLENYSNLVSVGYQLS
KPSVISQLEKGEEPWMAEKEGPGDPSSDSKSKMETTESTAKSAISQECLYHGTMMERFMR
DDIIYSTLRKVSTYDDVLERHQETCVRDVRQAILTHKKRVQETNKFGENIIVHSNVIIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
CKECGRAFSQSASLSTHQRIHTGEKPFGCEECGKAFRHRSSLNQHHRTHTGEKPYVCDKC
QKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF
SHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDS
SFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNNV
Download sequence
Identical sequences G1RNH3
ENSNLEP00000014787 XP_003273376.1.23891 XP_012366514.1.23891 ENSNLEP00000014787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]