SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015284 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015284
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-38
Family Dual specificity phosphatase-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015284   Gene: ENSNLEG00000012587   Transcript: ENSNLET00000016058
Sequence length 223
Comment pep:known_by_projection supercontig:Nleu1.0:GL397312.1:3402978:3445025:1 gene:ENSNLEG00000012587 transcript:ENSNLET00000016058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPILQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGTTGSLKRTHEEEDDFGTMQVATAQNG
Download sequence
Identical sequences A0A2I3H8M7 G3QHG7 Q5RDP3
ENSNLEP00000015284 ENSGGOP00000001796 NP_001153320.1.23681 XP_012359902.1.23891 XP_018865659.1.27298 ENSNLEP00000015284 ENSGGOP00000001796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]