SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015380 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015380
Domain Number 1 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 48-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-20
Family KRAB domain (Kruppel-associated box) 0.00072
Further Details:      
 
Domain Number 5 Region: 436-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 393-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 10 Region: 186-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000619
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015380   Gene: ENSNLEG00000012679   Transcript: ENSNLET00000016166
Sequence length 662
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:3527801:3550592:-1 gene:ENSNLEG00000012679 transcript:ENSNLET00000016166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCYGTFWGYPKMLEAANLMEGLVDICPWVTLPRGQPEVLGWGLPKDQDSVAFEDVAVNF
THEEWALLGPSQKNLYRDVMQETIRNLNCIGMKWETQNIDDQYQNLRRNPRCDMVERFGK
SKDGSQCGETLSQIRNSIVNKNTPARVDACGSSVNGEVIMGHSSLNCYIRVDTGHKHREC
HEYAEKPYTHKQCGKGLSYRHSFATRERPHTGKKPYDCKECGKTFSSPGNLRRHMVVKGG
DGPYKCELCGKAFFWPSLLRMHERAHTGEKPYECKHCSKAFPVYSSYLRHEKIHTGEKPY
ECKQCSKAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVSGSLRVHERIHTGEKPYTCKQ
CGKAFCHLGSFQRHMITHSGDGPHKCKICGKGFDFPGSARIHEGTHTLEKPYECKQCGKL
LSHRSSFRRHMMAHTGDGPHKCTVCGKAFDSPSVFQRHERTHTGEKPYECKQCGKAFRTS
SSLRKHEKTHTGEQPYKCKCGKAFSDFFSFQSHETTHSEEEPYECKECGKAFSSFKYFCR
HERTHSEEKSYECQTCGKAFSRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLLRHERT
HTGERPYECKHCGKAFSRSSFCQEHERTHTGEKPYECKECGKAFSSLSSFNRHKRTHLKD
IL
Download sequence
Identical sequences ENSNLEP00000015380 ENSNLEP00000015380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]