SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015388 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015388
Domain Number 1 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 231-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 290-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-20
Family KRAB domain (Kruppel-associated box) 0.00048
Further Details:      
 
Domain Number 9 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 11 Region: 502-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000533
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 90-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000973
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015388   Gene: ENSNLEG00000012687   Transcript: ENSNLET00000016174
Sequence length 640
Comment pep:novel supercontig:Nleu1.0:GL397381.1:3735284:3738136:-1 gene:ENSNLEG00000012687 transcript:ENSNLET00000016174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEEKNIEDHKNQGRK
LRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKDYMCHSSLNRHM
RSHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWPS
SFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRN
HERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHERI
HTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTGN
GPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPHE
CKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQC
GKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKAF
SCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGVKPYECKQCDKAFSCSR
SFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
Download sequence
Identical sequences ENSNLEP00000015388 ENSNLEP00000015388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]