SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015665 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015665
Domain Number 1 Region: 754-981
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 350-526
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-56
Family Regulator of G-protein signaling, RGS 0.0000000153
Further Details:      
 
Domain Number 3 Region: 985-1119
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-43
Family Pleckstrin-homology domain (PH domain) 0.000000248
Further Details:      
 
Domain Number 4 Region: 28-121
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015665
Domain Number - Region: 151-160,191-225
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0628
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015665   Gene: ENSNLEG00000012881   Transcript: ENSNLET00000016461
Sequence length 1557
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:7727827:7840856:-1 gene:ENSNLEG00000012881 transcript:ENSNLET00000016461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPKVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLY
GDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMA
RVAQHHRRQGSDAAVPSTGDQGVDQSTKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKDSRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLD
GDPLRERQVAEKQLAALGDIFSKYEEDRSAPMDFALNTYMSHAGIRLREARPTNTAEKAQ
SAPDKDKWLPFFPKTKKSSNSKREKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEV
KPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREE
MKRSRKAENVPRSRSDVDMDAAAEATHLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVIN
ELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLR
EEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYV
NEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDK
RAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPIPVHPPPPGPQ
EPAHQGPTPSRVELDDSDVFHGEPAPEELPGGTGSQQRVQGKHPVLQEGSAEEEELGVLP
CPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADSALEDVENLRHLILWSLLSGHTMETQ
ASQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGEGDNTQLAGPEGERPEQEDVGLCSL
EHLPPRTRNSGIWESPELDRNLAEEASSTEAAGGYKVVRKAEVAGSKVVPALPESGQSEP
GPPEVEGGTKATGNCFYVSMPSGPLDSSTDHSGAPTSPPQPDSLPAGQTEPQPQLQGGNG
DPICPSRSPPSLALRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLGGESSGGTTPVG
SFHTEAARWTDGSLSPPTKEPLASDSRNSHELGPCPEDGSDAPLEDSAADAATLPGP
Download sequence
Identical sequences ENSNLEP00000015665 ENSNLEP00000015665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]