SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015740 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015740
Domain Number 1 Region: 68-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 226-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000118
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015740
Domain Number - Region: 132-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.000136
Family VWC domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015740   Gene: ENSNLEG00000012965   Transcript: ENSNLET00000016541
Sequence length 372
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:3711497:3726866:1 gene:ENSNLEG00000012965 transcript:ENSNLET00000016541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRRLLYPSGWLHGPSDMQGLLFSTLLLAGLAQFCCRAQGTGPLDTTPKGRPGEVSDAP
QRKQFCHWPCKCPHQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDY
SVDRPRYETGVCAYLVAVGCEFNRVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAG
SHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRT
CGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVF
SGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCR
EPGDIFSELKIL
Download sequence
Identical sequences G1RR76
XP_003255630.1.23891 ENSNLEP00000015740 ENSNLEP00000015740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]