SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015773 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015773
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 44-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 391-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 199-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000253
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015773
Domain Number - Region: 144-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00369
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015773   Gene: ENSNLEG00000013001   Transcript: ENSNLET00000016574
Sequence length 448
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:32513244:32532906:1 gene:ENSNLEG00000013001 transcript:ENSNLET00000016574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKQVILEVVRQVRPLITMPSFFLYSSSAFIVLCLSQKLQKMNKSQGSVSFTDVTVDFTQ
EEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMERDHRNPDEQARQFLILKNQTPI
EERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDLLNSNRSYAGKQTNECNEFGK
ALLYLKQEKTHAGVEYSEYSKSGKALSHKAAIFKHQKIKNLVQPFICTYCDKAFSFKSLL
ISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPFECPECGKAFTHQSNLIVHQ
RAHMEKKPYECSECGKTFAQKFELTTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHT
GEKRYECSECGKSFIQNSQLIIHMRTHTGEKPYECTECGKTFSQRSTLRLHLRIHTGEKP
YECSECGKAFSRKSRLSVHQRVHIGDKP
Download sequence
Identical sequences ENSNLEP00000015773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]