SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016071 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016071
Domain Number 1 Region: 12-157
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-34
Family Dual specificity phosphatase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016071   Gene: ENSNLEG00000013271   Transcript: ENSNLET00000016892
Sequence length 159
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:10259412:10260988:1 gene:ENSNLEG00000013271 transcript:ENSNLET00000016892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARKAPRPTMGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSD
SCPSLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLV
KERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Download sequence
Identical sequences ENSNLEP00000016071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]