SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016246 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016246
Domain Number 1 Region: 314-502
Classification Level Classification E-value
Superfamily PUA domain-like 5.47e-66
Family SRA domain-like 0.00000000502
Further Details:      
 
Domain Number 2 Region: 604-661
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000114
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 204-255
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000266
Family PHD domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016246
Domain Number - Region: 1-47
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.019
Family Ubiquitin-related 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016246   Gene: ENSNLEG00000013406   Transcript: ENSNLET00000017079
Sequence length 682
Comment pep:known_by_projection supercontig:Nleu1.0:GL397500.1:433746:466145:1 gene:ENSNLEG00000013406 transcript:ENSNLET00000017079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMEDGHTLFDYEVRMNDTIQLLVRQSLVLPHSAKERDSELSDTDSGCCLGQSESDKSSTH
GETAAETDSRPADEDMWDETELGLYKVSLLSAAAVGLDGWFPARSLRGTRYPGIPFCCPR
HPENPWCSSAVSRFRGLGRPEFSSVLIPCRDDSLNDCRIIFVDEVFKIERPGEGSPMVDN
PMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLNPPLSSV
PSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGSPCCGYQLECSG
AVSAHYNLPLPPSPVAGRWSFSAAVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYKDDVD
HGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGK
PVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWT
KEGKDRTKKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKS
AGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPF
QLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYA
MQVNQPLQTVLNQLFPGYGNGR
Download sequence
Identical sequences ENSNLEP00000016246 ENSNLEP00000016246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]