SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016457 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016457
Domain Number 1 Region: 166-550
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-159
Family Myotubularin-like phosphatases 0.0000000000311
Further Details:      
 
Domain Number 2 Region: 42-162
Classification Level Classification E-value
Superfamily PH domain-like 3.63e-42
Family GRAM domain 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016457   Gene: ENSNLEG00000013579   Transcript: ENSNLET00000017301
Sequence length 634
Comment pep:known_by_projection supercontig:Nleu1.0:GL397341.1:7186405:7275707:1 gene:ENSNLEG00000013579 transcript:ENSNLET00000017301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLRVSRMASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYIC
PFNGPIKGRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITC
KDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLPLFAFLNEEKFNVDGWTVYNPVEEY
RRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHP
ENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANKATGG
GYESDDAYHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLV
LTGAIQVADKVASGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWIS
FGHKFASRIGHGDKNHTDADRSPIFLQFIDCVWQMSKQFPTAFEFNEQFLIIILDHLYSC
RFGTFLFNCESARERQKVTERTVSLWSLINSNKEKFKNPFYTKEIHRVLYPVASMRHLEL
WVNYYIRWNPRIKQQQPNPVEQRYMELLTLLDEYIKRLEELQLANSAQLSDPPTSPSSPS
HMMPHVQTHFLRGTLALHLELEIKAIADFHLGHL
Download sequence
Identical sequences ENSNLEP00000016457 XP_012354600.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]