SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016459 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016459
Domain Number 1 Region: 339-470
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000557
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 311-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000232
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 272-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000487
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 10-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000637
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 466-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000166
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016459
Domain Number - Region: 234-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000138
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 503-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0104
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016459   Gene: ENSNLEG00000013596   Transcript: ENSNLET00000017303
Sequence length 657
Comment pep:known_by_projection supercontig:Nleu1.0:GL397366.1:2735408:3100377:-1 gene:ENSNLEG00000013596 transcript:ENSNLET00000017303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCTCSAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYLCICNEGYEGPNCEQALPS
LPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIP
DIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSV
TPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLE
CSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQNNASCIDANEKQDGSNFTC
VCLPGYTGELCQSKIDYCILDPCRNGATCISSLNGFTCQCPEGYFGSACEEKVDPCASSP
CQNNGTCYVDGVHFTCSCSPGFTGPTCAQLIDFCALSPCAHGTCRSVGTSYKCLCDPGYH
GLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATC
DSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCXXXXXXXXXXXPATCLFLPADL
QWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRPAYEEF
YNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences ENSNLEP00000016459 ENSNLEP00000016459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]