SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016799 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016799
Domain Number 1 Region: 574-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000389
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 611-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000174
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000576
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000867
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016799   Gene: ENSNLEG00000013845   Transcript: ENSNLET00000017651
Sequence length 708
Comment pep:known_by_projection supercontig:Nleu1.0:GL397273.1:34423889:34432745:1 gene:ENSNLEG00000013845 transcript:ENSNLET00000017651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRKEPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVFSGGGGGAFLHHEHAARQG
AVPAADGLGLSPKPPAPDFAAPSQAGTLRPNPQGPPPVQACGAREGIKREASSAPSATSP
TPGKWGQPKKGKEQLDRALDMSGAARGQGHFFGIAGGSSAGVGSLAFYPGVRSAFKPAGL
ARAAAASHGDPYREESSSKQGAGLALGRLLGGGRACGRPGSGENSAAGGAGHHHHHHAHH
HHHPKCLLAGDPLPPPPPPGLPCSGALRGLPVLSVPPEEASAFKHVERAPPAAAALPGAR
YAQLPPAPGLPLERCALPPLDTGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPATTAY
YPLKLHFGGLLKYPESISYFSGPAAAALSPAELGSLANIDREIAMHNQQLSEMAAGKGRG
RLDSGTLPPAVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYK
PLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLL
AKAGDGPGAEPGYPPEPGDSKSDDSDVDVCFTDDQSDPEAGGGGERDL
Download sequence
Identical sequences G1RU74
ENSNLEP00000016799 XP_003258419.1.23891 ENSNLEP00000016799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]