SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016907 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016907
Domain Number 1 Region: 123-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.26e-145
Family Myotubularin-like phosphatases 0.000000024
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 7.23e-18
Family GRAM domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016907
Domain Number - Region: 493-543
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.018
Family MED7 hinge region 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016907   Gene: ENSNLEG00000013889   Transcript: ENSNLET00000017761
Sequence length 621
Comment pep:known_by_projection supercontig:Nleu1.0:GL397353.1:4167467:4211220:-1 gene:ENSNLEG00000013889 transcript:ENSNLET00000017761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIASVEKLA
LTTSGCPLVIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSE
RLQGWQLIDLAEEYKRMGVPNSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHQDKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVNDFYS
GLESSGWLRHIKAVMDAAIFLAKAITVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRT
IRGFMVLIEKDWISFGHKFSERCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEA
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSKSHRF
TVLEPNTVSFHFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQR
KNKQTDGILTKELLHSVHPESPTLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAE
EFSKSEPAVVSLEYGVARMTC
Download sequence
Identical sequences A0A2I3HPM5
ENSNLEP00000016907 XP_003273177.1.23891 ENSNLEP00000016907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]