SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017498 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017498
Domain Number 1 Region: 39-232
Classification Level Classification E-value
Superfamily L domain-like 7.37e-40
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 2 Region: 231-342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000213
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017498   Gene: ENSNLEG00000014396   Transcript: ENSNLET00000018369
Sequence length 428
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:17981431:17984567:1 gene:ENSNLEG00000014396 transcript:ENSNLET00000018369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQELHLLWWAVLLGLAQACPEPCDCGEKYGFQIADCAYRDLEAVPPGFQANVTTLSLSAN
RLPSLPEGAFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWRDLHN
LSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINDN
PFDCTCGIVWLKTWALATSVSIPEQDNIACTSPHVLKGTPLSRLPPLPCSAPSVQLSYQP
SQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPGTPVASS
QPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFH
GKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQLPPGLLLLGQSLL
LLFLLTSF
Download sequence
Identical sequences G1RW71
ENSNLEP00000017498 ENSNLEP00000017498 XP_003267248.1.23891 XP_003267249.1.23891 XP_004088358.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]