SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017664 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017664
Domain Number 1 Region: 39-181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.89e-33
Family Dual specificity phosphatase-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017664   Gene: ENSNLEG00000014515   Transcript: ENSNLET00000018545
Sequence length 353
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:12076845:12084959:1 gene:ENSNLEG00000014515 transcript:ENSNLET00000018545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAQGAAWPLGAAMLDAPGPSHGCELGNPSASRVSCAGQMLEVQPGLYLGGAAAVAEPDH
LREAGITAVLTVDSEEPSFKAGPGVEGLWHLFVPALDKPETDLLSHLDRCVAFIGQARAE
GRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQA
MGCEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTISQGLKDEVLYKCRKCRRS
LFRSSSILDHHEGSGPIAFAHKRMTPSFMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQ
LLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTRKI
Download sequence
Identical sequences ENSNLEP00000017664 XP_003258822.2.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]