SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017752 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017752
Domain Number 1 Region: 153-422
Classification Level Classification E-value
Superfamily Subtilisin-like 4.32e-56
Family Subtilases 0.0000253
Further Details:      
 
Domain Number 2 Region: 75-152
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000085
Family Subtilase propeptides/inhibitors 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017752   Gene: ENSNLEG00000014590   Transcript: ENSNLET00000018639
Sequence length 693
Comment pep:known_by_projection supercontig:Nleu1.0:GL397299.1:10625914:10649338:1 gene:ENSNLEG00000014590 transcript:ENSNLET00000018639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTVSSRRSWWPLPLLLLLLLLLLGPAGAHAQEDEDGDYEELVLALRSEEDGLADAPEHG
ATATFHRCAKDPWRLPGTYVVVLKEEAHRSQSERTARRLQAQAARRGYLTKILHVFHDLL
PGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRVDEYQPPDGGSL
VEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQAIKCDSHGTHLAGVVSGRDA
GVAKGAGLRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNA
ACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCV
DLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFS
AKDVINESWFPEDQRVLTPNLVAALPPGTHGAGWQLFCRTVWSAHSGPTRMATAVARCAP
DEELLSCSSFSRSGKRRGERMEAQGGKRVCRAHNAFGGEGVYAVARCCLLPQANCSVHTA
PPAGAGMGTRVRCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPQGQPNQCVGHREASIHAS
CCRAPGLECKVKEHGNPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSR
DVSTTGSTSEEAVAAIAICCRRWHLAQASQELQ
Download sequence
Identical sequences G1RWX5
XP_003265178.1.23891 ENSNLEP00000017752 ENSNLEP00000017752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]