SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017843 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017843
Domain Number 1 Region: 21-186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.14e-32
Family Dual specificity phosphatase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017843   Gene: ENSNLEG00000014681   Transcript: ENSNLET00000018733
Sequence length 201
Comment pep:known_by_projection supercontig:Nleu1.0:GL397449.1:1689818:1695890:1 gene:ENSNLEG00000014681 transcript:ENSNLET00000018733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLV
QDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALK
YQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLK
EFHKQITGGAAKDGTFDISKT
Download sequence
Identical sequences A0A2I3FXX4
ENSNLEP00000017843 XP_003279033.1.23891 ENSNLEP00000017843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]